Lineage for d1qh6b_ (1qh6 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371831Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 371866Protein Xylanase II [49979] (15 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 371874Species Bacillus agaradhaerens [TaxId:76935] [49982] (4 PDB entries)
  8. 371880Domain d1qh6b_: 1qh6 B: [24320]
    complexed with fxp

Details for d1qh6b_

PDB Entry: 1qh6 (more details), 2 Å

PDB Description: catalysis and specificity in enzymatic glycoside hydrolases: a 2,5b conformation for the glycosyl-enzyme intermidiate revealed by the structure of the bacillus agaradhaerens family 11 xylanase

SCOP Domain Sequences for d1qh6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qh6b_ b.29.1.11 (B:) Xylanase II {Bacillus agaradhaerens}
eivtdnsignhdgydyefwkdsggsgtmilnhggtfsaqwnnvnnilfrkgkkfnetqth
qqvgnmsinyganfqpngnaylcvygwtvdplveyyivdswgnwrppgatpkgtitvdgg
tydiyetlrvnqpsikgiatfkqywsvrrskrtsgtisvsnhfrawenlgmnmgkmyeva
ltvegyqssgsanvysntlringnpls

SCOP Domain Coordinates for d1qh6b_:

Click to download the PDB-style file with coordinates for d1qh6b_.
(The format of our PDB-style files is described here.)

Timeline for d1qh6b_: