SCOPe 2.08: Domain d1qh6b_: 1qh6 B:

Lineage for d1qh6b_ (1qh6 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus agaradhaerens [TaxId:76935] [49982] (4 PDB entries)

8. Domain d1qh6b_: 1qh6 B: [24320]

Details for d1qh6b_

PDB Entry: 1qh6, 2 Å

PDB Description: catalysis and specificity in enzymatic glycoside hydrolases: a 2,5b conformation for the glycosyl-enzyme intermidiate revealed by the structure of the bacillus agaradhaerens family 11 xylanase

PDB Compounds: (B:) xylanase

SCOPe Domain Sequences for d1qh6b_:

Sequence; same for both SEQRES and ATOM records:

>d1qh6b_ b.29.1.11 (B:) Xylanase II {Bacillus agaradhaerens [TaxId: 76935]}
eivtdnsignhdgydyefwkdsggsgtmilnhggtfsaqwnnvnnilfrkgkkfnetqth
qqvgnmsinyganfqpngnaylcvygwtvdplveyyivdswgnwrppgatpkgtitvdgg
tydiyetlrvnqpsikgiatfkqywsvrrskrtsgtisvsnhfrawenlgmnmgkmyeva
ltvegyqssgsanvysntlringnpls

Timeline for d1qh6b_:

• d1qh6b_ first appeared (with stable ids) in SCOP 1.55
  
• d1qh6b_ appears in SCOPe 2.07