Lineage for d1axkb2 (1axk B:157-341)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 165029Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 165041Protein Xylanase II [49979] (13 species)
  7. 165070Species Bacillus subtilis [TaxId:1423] [49981] (1 PDB entry)
  8. 165072Domain d1axkb2: 1axk B:157-341 [24316]
    Other proteins in same PDB: d1axka1, d1axkb1

Details for d1axkb2

PDB Entry: 1axk (more details), 2.1 Å

PDB Description: engineered bacillus bifunctional enzyme gluxyn-1

SCOP Domain Sequences for d1axkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axkb2 b.29.1.11 (B:157-341) Xylanase II {Bacillus subtilis}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOP Domain Coordinates for d1axkb2:

Click to download the PDB-style file with coordinates for d1axkb2.
(The format of our PDB-style files is described here.)

Timeline for d1axkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axkb1