Lineage for d2ma9b_ (2ma9 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1892571Protein Elongin B [54246] (2 species)
  7. 1892572Species Human (Homo sapiens) [TaxId:9606] [54247] (27 PDB entries)
  8. 1892667Domain d2ma9b_: 2ma9 B: [243156]
    Other proteins in same PDB: d2ma9c_
    automated match to d3zrcg_

Details for d2ma9b_

PDB Entry: 2ma9 (more details)

PDB Description: hiv-1 vif socs-box and elongin bc solution structure
PDB Compounds: (B:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d2ma9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ma9b_ d.15.1.1 (B:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq

SCOPe Domain Coordinates for d2ma9b_:

Click to download the PDB-style file with coordinates for d2ma9b_.
(The format of our PDB-style files is described here.)

Timeline for d2ma9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ma9c_