| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Elongin B [54246] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54247] (27 PDB entries) |
| Domain d2ma9b_: 2ma9 B: [243156] Other proteins in same PDB: d2ma9c_ automated match to d3zrcg_ |
PDB Entry: 2ma9 (more details)
SCOPe Domain Sequences for d2ma9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ma9b_ d.15.1.1 (B:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
Timeline for d2ma9b_: