Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (30 PDB entries) |
Domain d2ma9c_: 2ma9 C: [243157] Other proteins in same PDB: d2ma9b_ automated match to d4b9kb_ |
PDB Entry: 2ma9 (more details)
SCOPe Domain Sequences for d2ma9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ma9c_ d.42.1.1 (C:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} vklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmyft ykvrytnssteipefpiapeialellmaanf
Timeline for d2ma9c_: