SCOPe 2.05: Domain d2ma9c_: 2ma9 C:

Lineage for d2ma9c_ (2ma9 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Elongin C [54699] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (30 PDB entries)

8. Domain d2ma9c_: 2ma9 C: [243157]
   Other proteins in same PDB: d2ma9b_
   automated match to d4b9kb_

Details for d2ma9c_

PDB Entry: 2ma9

PDB Description: hiv-1 vif socs-box and elongin bc solution structure

PDB Compounds: (C:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d2ma9c_:

Sequence; same for both SEQRES and ATOM records:

>d2ma9c_ d.42.1.1 (C:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
vklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmyft
ykvrytnssteipefpiapeialellmaanf

Timeline for d2ma9c_:

• d2ma9c_ first appeared in SCOPe 2.04
  
• d2ma9c_ appears in SCOPe 2.06
  
• d2ma9c_ appears in the current release, SCOPe 2.08