SCOPe 2.08: Domain d2m8wa1: 2m8w A:1-83

Lineage for d2m8wa1 (2m8w A:1-83)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.267: Hypothetical protein SAV1430 [110835] (1 superfamily)
   beta(3)-alpha-beta(2)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet, order: 12543

4. Superfamily d.267.1: Hypothetical protein SAV1430 [110836] (2 families)
   automatically mapped to Pfam PF08712

5. Family d.267.1.1: Hypothetical protein SAV1430 [110837] (2 proteins)

6. Protein Hypothetical protein SAV1430 [110838] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110839] (3 PDB entries)
   Uniprot Q99U58

8. Domain d2m8wa1: 2m8w A:1-83 [243148]
   Other proteins in same PDB: d2m8wa2
   automated match to d1pqxa_

Details for d2m8wa1

PDB Entry: 2m8w

PDB Description: Restrained CS-Rosetta Solution NMR Structure of Staphylococcus aureus protein SAV1430. Northeast Structural Genomics Target ZR18. Structure determination

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2m8wa1:

Sequence; same for both SEQRES and ATOM records:

>d2m8wa1 d.267.1.1 (A:1-83) Hypothetical protein SAV1430 {Staphylococcus aureus [TaxId: 1280]}
mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdf
isvdkendanwetvlpkveavfe

Timeline for d2m8wa1:

• d2m8wa1 first appeared in SCOPe 2.04, called d2m8wa_
  
• d2m8wa1 appears in SCOPe 2.07