PDB entry 2m8w

View 2m8w on RCSB PDB site
Description: Restrained CS-Rosetta Solution NMR Structure of Staphylococcus aureus protein SAV1430. Northeast Structural Genomics Target ZR18. Structure determination
Class: unknown function
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, UNKNOWN FUNCTION
Deposited on 2013-05-29, released 2013-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uncharacterized protein
  Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
  Gene: SAV1430
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99U58 (0-82)
    • expression tag (83-90)
  Domains in SCOPe 2.08: d2m8wa1, d2m8wa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2m8wA (A:)
  mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdf
  isvdkendanwetvlpkveavfelehhhhhh