![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) |
![]() | Protein Xylanase II [49979] (16 species) Partial overlap with common fold and the active sites of the other endoglucanases |
![]() | Species Bacillus circulans [TaxId:1397] [49980] (9 PDB entries) |
![]() | Domain d1bvv__: 1bvv - [24313] complexed with dfx, xys |
PDB Entry: 1bvv (more details), 1.8 Å
SCOP Domain Sequences for d1bvv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvv__ b.29.1.11 (-) Xylanase II {Bacillus circulans} astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss nvtvw
Timeline for d1bvv__: