Lineage for d1bvva_ (1bvv A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664069Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 664114Protein Xylanase II [49979] (16 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 664135Species Bacillus circulans [TaxId:1397] [49980] (10 PDB entries)
  8. 664143Domain d1bvva_: 1bvv A: [24313]
    complexed with dfx, xys

Details for d1bvva_

PDB Entry: 1bvv (more details), 1.8 Å

PDB Description: sugar ring distortion in the glycosyl-enzyme intermediate of a family g/11 xylanase
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOP Domain Sequences for d1bvva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvva_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOP Domain Coordinates for d1bvva_:

Click to download the PDB-style file with coordinates for d1bvva_.
(The format of our PDB-style files is described here.)

Timeline for d1bvva_: