Lineage for d1c5ha_ (1c5h A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308405Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 1308450Protein Xylanase II [49979] (18 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 1308473Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)
  8. 1308479Domain d1c5ha_: 1c5h A: [24311]

Details for d1c5ha_

PDB Entry: 1c5h (more details), 1.55 Å

PDB Description: hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1c5ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5ha_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgdfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOPe Domain Coordinates for d1c5ha_:

Click to download the PDB-style file with coordinates for d1c5ha_.
(The format of our PDB-style files is described here.)

Timeline for d1c5ha_: