Lineage for d1c5ha_ (1c5h A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371831Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 371866Protein Xylanase II [49979] (15 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 371885Species Bacillus circulans [TaxId:1397] [49980] (9 PDB entries)
  8. 371888Domain d1c5ha_: 1c5h A: [24311]
    mutant

Details for d1c5ha_

PDB Entry: 1c5h (more details), 1.55 Å

PDB Description: hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase

SCOP Domain Sequences for d1c5ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5ha_ b.29.1.11 (A:) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgdfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOP Domain Coordinates for d1c5ha_:

Click to download the PDB-style file with coordinates for d1c5ha_.
(The format of our PDB-style files is described here.)

Timeline for d1c5ha_: