SCOPe 2.05: Domain d2m0ua_: 2m0u A:

Lineage for d2m0ua_ (2m0u A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (84 PDB entries)

8. Domain d2m0ua_: 2m0u A: [243067]
   automated match to d3ngha_

Details for d2m0ua_

PDB Entry: 2m0u

PDB Description: Complex structure of C-terminal CFTR peptide and extended PDZ1 domain from NHERF1

PDB Compounds: (A:) Na(+)/H(+) exchange regulatory cofactor NHE-RF1

SCOPe Domain Sequences for d2m0ua_:

Sequence; same for both SEQRES and ATOM records:

>d2m0ua_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gidpftmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevn
genvekethqqvvsriraalnavrllvvdpetdeqlqklgvqvreellraqeapgqa

Timeline for d2m0ua_:

• d2m0ua_ first appeared in SCOPe 2.04
  
• d2m0ua_ is called d2m0ua1 in SCOPe 2.06
  
• d2m0ua_ appears in the current release, SCOPe 2.08, called d2m0ua1