SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2m0ua1 (2m0u A:11-120)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048811Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2048812Protein automated matches [190436] (8 species)
    not a true protein
  7. 2048826Species Human (Homo sapiens) [TaxId:9606] [187333] (87 PDB entries)
  8. 2048948Domain d2m0ua1: 2m0u A:11-120 [243067]
    Other proteins in same PDB: d2m0ua2
    automated match to d3ngha_

Details for d2m0ua1

PDB Entry: 2m0u (more details)

PDB Description: Complex structure of C-terminal CFTR peptide and extended PDZ1 domain from NHERF1
PDB Compounds: (A:) Na(+)/H(+) exchange regulatory cofactor NHE-RF1

SCOPe Domain Sequences for d2m0ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m0ua1 b.36.1.0 (A:11-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenveke
thqqvvsriraalnavrllvvdpetdeqlqklgvqvreellraqeapgqa

SCOPe Domain Coordinates for d2m0ua1:

Click to download the PDB-style file with coordinates for d2m0ua1.
(The format of our PDB-style files is described here.)

Timeline for d2m0ua1: