Lineage for d1a39a_ (1a39 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119246Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
  6. 1119247Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)
  7. 1119264Species Humicola insolens, Cel7b [TaxId:34413] [49977] (6 PDB entries)
  8. 1119271Domain d1a39a_: 1a39 A: [24305]
    complexed with nag; mutant

Details for d1a39a_

PDB Entry: 1a39 (more details), 2.2 Å

PDB Description: humicola insolens endocellulase egi s37w, p39w double-mutant
PDB Compounds: (A:) endoglucanase I

SCOPe Domain Sequences for d1a39a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a39a_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Humicola insolens, Cel7b [TaxId: 34413]}
ekpgetkevhpqlttfrctkrggckpatnfivldslwhwihraeglgpggcgdwgnpppk
dvcpdvescakncimegipdysqygvttngtslrlqhilpdgrvpsprvylldktkrrye
mlhltgfeftfdvdatklpcgmnsalylsemhptgakskynpggayygtgycdaqcfvtp
finglgniegkgsccnemdiweansrashvaphtcnkkglylcegeecafegvcdkngcg
wnnyrvnvtdyygrgeefkvntlkpftvvtqflanrrgklekihrfyvqdgkviesfytn
kegvpytnmiddefceatgsrkymelgatqgmgealtrgmvlamsiwwdqggnmewldhg
eagpcakgegapsnivqvepfpevtytnlrwgeigstyqelq

SCOPe Domain Coordinates for d1a39a_:

Click to download the PDB-style file with coordinates for d1a39a_.
(The format of our PDB-style files is described here.)

Timeline for d1a39a_: