Lineage for d2lxhc_ (2lxh C:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264067Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2264068Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2264199Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 2264200Protein automated matches [190242] (3 species)
    not a true protein
  7. 2264203Species Human (Homo sapiens) [TaxId:9606] [189860] (5 PDB entries)
  8. 2264211Domain d2lxhc_: 2lxh C: [243024]
    automated match to d1iyma_
    complexed with zn

Details for d2lxhc_

PDB Entry: 2lxh (more details)

PDB Description: NMR structure of the RING domain in ubiquitin ligase gp78
PDB Compounds: (C:) E3 ubiquitin-protein ligase AMFR

SCOPe Domain Sequences for d2lxhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lxhc_ g.44.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avatpeelavnnddcaicwdsmqaarklpcghlfhnsclrswleqdtscptcrmslni

SCOPe Domain Coordinates for d2lxhc_:

Click to download the PDB-style file with coordinates for d2lxhc_.
(The format of our PDB-style files is described here.)

Timeline for d2lxhc_: