Class a: All alpha proteins [46456] (289 folds) |
Fold a.155: H-NS histone-like proteins [81274] (1 superfamily) multihelical oligomeric protein; structure of whole subunit is not known yet but are probably composed of three different domains |
Superfamily a.155.1: H-NS histone-like proteins [81273] (1 family) available NMR structures suggest two very different dimerisation modes of the N-terminal domain |
Family a.155.1.1: H-NS histone-like proteins [81272] (3 proteins) |
Protein automated matches [254595] (2 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255457] (1 PDB entry) |
Domain d2lrxa_: 2lrx A: [242985] automated match to d1hnra_ |
PDB Entry: 2lrx (more details)
SCOPe Domain Sequences for d2lrxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lrxa_ a.155.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} rqprpakykftdvngetktwtgqgrtpkpiaqalaegkslddfli
Timeline for d2lrxa_: