Lineage for d2lrqa_ (2lrq A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394630Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2394814Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 2394815Protein automated matches [191139] (6 species)
    not a true protein
  7. 2394818Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189399] (4 PDB entries)
  8. 2394824Domain d2lrqa_: 2lrq A: [242982]
    automated match to d2f5ke_

Details for d2lrqa_

PDB Entry: 2lrq (more details)

PDB Description: Chemical Shift Assignment and Solution Structure of Fr822A from Drosophila melanogaster. Northeast Structural Genomics Consortium Target Fr822A
PDB Compounds: (A:) NuA4 complex subunit EAF3 homolog

SCOPe Domain Sequences for d2lrqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lrqa_ b.34.13.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mnystgtdantlfvdgervlcfhgpliyeakvlktkpdatpveyyihyagwsknwdewvp
enrvlkynddnvkrrqelarqcger

SCOPe Domain Coordinates for d2lrqa_:

Click to download the PDB-style file with coordinates for d2lrqa_.
(The format of our PDB-style files is described here.)

Timeline for d2lrqa_: