Lineage for d2lqpa_ (2lqp A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489858Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1489910Protein Calmodulin [47516] (12 species)
  7. 1489995Species Human (Homo sapiens) [TaxId:9606] [47517] (80 PDB entries)
    Uniprot P02593
  8. 1490122Domain d2lqpa_: 2lqp A: [242969]
    automated match to d1cmga_
    complexed with ca

Details for d2lqpa_

PDB Entry: 2lqp (more details)

PDB Description: NMR solution structure of the Ca2+-Calmodulin C-terminal domain in a complex with a peptide (NSCaTE) from the L-type Voltage-Gated Calcium Channel alpha1C subunit
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2lqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lqpa_ a.39.1.5 (A:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
dtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvn
yeefvqmmtak

SCOPe Domain Coordinates for d2lqpa_:

Click to download the PDB-style file with coordinates for d2lqpa_.
(The format of our PDB-style files is described here.)

Timeline for d2lqpa_: