Lineage for d3ovwa_ (3ovw A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119246Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
  6. 1119247Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)
  7. 1119251Species Fungus (Fusarium oxysporum) [TaxId:5507] [49976] (4 PDB entries)
  8. 1119252Domain d3ovwa_: 3ovw A: [24292]
    complexed with nag

Details for d3ovwa_

PDB Entry: 3ovw (more details), 2.3 Å

PDB Description: endoglucanase i native structure
PDB Compounds: (A:) endoglucanase I

SCOPe Domain Sequences for d3ovwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ovwa_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Fungus (Fusarium oxysporum) [TaxId: 5507]}
etpdkakeqhpkletyrctkasgckkqtnyivadagihgirqkngagcgdwgqkpnatac
pdeascakncilsgmdsnayknagittsgnklrlqqlinnqlvsprvylleenkkkyeml
hltgtefsfdvemeklpcgmngalylsempqdggkstsrnskagayygagycdaqcyvtp
fingvgnikgqgvccneldiweansrathiaphpcskpglygctgdecgssgicdkagcg
wnhnrinvtdfygrgkqykvdstrkftvtsqfvankqgdlielhrhyiqdnkviesavvn
isgppkinfindkycaatganeymrlggtkqmgdamsrgmvlamsvwwsegdfmawldqg
vagpcdategdpknivkvqpnpevtfsnirigeigstssv

SCOPe Domain Coordinates for d3ovwa_:

Click to download the PDB-style file with coordinates for d3ovwa_.
(The format of our PDB-style files is described here.)

Timeline for d3ovwa_: