SCOPe 2.08: Domain d2lkda1: 2lkd A:5-178

Lineage for d2lkda1 (2lkd A:5-178)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [188756] (8 PDB entries)

8. Domain d2lkda1: 2lkd A:5-178 [242914]
   Other proteins in same PDB: d2lkda2
   automated match to d2gcob_
   complexed with gdp

Details for d2lkda1

PDB Entry: 2lkd

PDB Description: IF2-G2 GDP complex

PDB Compounds: (A:) Translation initiation factor IF-2

SCOPe Domain Sequences for d2lkda1:

Sequence; same for both SEQRES and ATOM records:

>d2lkda1 c.37.1.0 (A:5-178) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
verppvvtimghvdhgkttlldairhskvteqeaggitqhigayqvtvndkkitfldtpg
heafttmrargaqvtdivilvvaaddgvmpqtveainhakaanvpiivainkmdkpeanp
drvmqelmeynlvpeewggdtifcklsaktkegldhllemillvsemeelkanp

Timeline for d2lkda1:

• d2lkda1 first appeared in SCOPe 2.04, called d2lkda_
  
• d2lkda1 appears in SCOPe 2.07