SCOPe 2.06: Domain d2lk6a_: 2lk6 A:

Lineage for d2lk6a_ (2lk6 A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
   automatically mapped to Pfam PF06397

6. Protein Desulforedoxin [57814] (1 species)
   dimeric mono-domain protein with two rubredoxin-type metal centres

7. Species Desulfovibrio gigas [TaxId:879] [57815] (6 PDB entries)

8. Domain d2lk6a_: 2lk6 A: [242910]
   automated match to d1dxga_
   complexed with cd

Details for d2lk6a_

PDB Entry: 2lk6

PDB Description: NMR determination of the global structure of the Cd-113 derivative of desulforedoxin

PDB Compounds: (A:) desulforedoxin

SCOPe Domain Sequences for d2lk6a_:

Sequence; same for both SEQRES and ATOM records:

>d2lk6a_ g.41.5.2 (A:) Desulforedoxin {Desulfovibrio gigas [TaxId: 879]}
anegdvykcelcgqvvkvleegggtlvccgedmvkq

Timeline for d2lk6a_:

• d2lk6a_ first appeared in SCOPe 2.04
  
• d2lk6a_ appears in SCOPe 2.05
  
• d2lk6a_ appears in SCOPe 2.07
  
• d2lk6a_ appears in the current release, SCOPe 2.08