SCOPe 2.08: Domain d2lgva1: 2lgv A:12-108

Lineage for d2lgva1 (2lgv A:12-108)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries)
   Uniprot P62877 19-106

8. Domain d2lgva1: 2lgv A:12-108 [242877]
   Other proteins in same PDB: d2lgva2
   automated match to d3dplr_
   complexed with zn
   has additional insertions and/or extensions that are not grouped together

Details for d2lgva1

PDB Entry: 2lgv

PDB Description: Rbx1

PDB Compounds: (A:) E3 ubiquitin-protein ligase RBX1

SCOPe Domain Sequences for d2lgva1:

Sequence; same for both SEQRES and ATOM records:

>d2lgva1 g.44.1.1 (A:12-108) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
gtnsgagkkrfevkksnasaqsawdivvdncaicrnhimdlciecqanqasatseectva
wgvcnhafhfhcisrwlktrqvcpldnrewefqkygh

Timeline for d2lgva1:

• d2lgva1 first appeared in SCOPe 2.04, called d2lgva_
  
• d2lgva1 appears in SCOPe 2.07