Lineage for d2lexa_ (2lex A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038703Fold g.79: WRKY DNA-binding domain [118289] (1 superfamily)
    zinc-bound 4-stranded meander beta-sheet, distinct from the beta-ribbon motifs
  4. 3038704Superfamily g.79.1: WRKY DNA-binding domain [118290] (2 families) (S)
  5. 3038705Family g.79.1.1: WRKY DNA-binding domain [118291] (1 protein)
    Pfam PF03106
  6. 3038706Protein WRKY DNA-binding protein 4 [118292] (1 species)
  7. 3038707Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118293] (2 PDB entries)
    Uniprot Q9XI90 399-468
  8. 3038708Domain d2lexa_: 2lex A: [242862]
    automated match to d1wj2a_
    protein/DNA complex; complexed with zn

Details for d2lexa_

PDB Entry: 2lex (more details)

PDB Description: Complex of the C-terminal WRKY domain of AtWRKY4 and a W-box DNA
PDB Compounds: (A:) Probable WRKY transcription factor 4

SCOPe Domain Sequences for d2lexa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lexa_ g.79.1.1 (A:) WRKY DNA-binding protein 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
llddgyrwrkygqkvvkgnpyprsyykcttpgcgvrkhveraatdpkavvttyegkhnhd
lpa

SCOPe Domain Coordinates for d2lexa_:

Click to download the PDB-style file with coordinates for d2lexa_.
(The format of our PDB-style files is described here.)

Timeline for d2lexa_: