Lineage for d2lcka_ (2lck A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028358Fold f.42: Mitochondrial carrier [103505] (1 superfamily)
    membrane all-alpha fold; 6-helical "barrel" with internal binding cavity
  4. 3028359Superfamily f.42.1: Mitochondrial carrier [103506] (2 families) (S)
    duplication: consists of three alpha-hairpin repeats
  5. 3028367Family f.42.1.0: automated matches [236111] (1 protein)
    not a true family
  6. 3028368Protein automated matches [236112] (2 species)
    not a true protein
  7. 3028371Species Mouse (Mus musculus) [TaxId:10090] [255427] (1 PDB entry)
  8. 3028372Domain d2lcka_: 2lck A: [242844]
    automated match to d1okca_

Details for d2lcka_

PDB Entry: 2lck (more details)

PDB Description: Structure of the mitochondrial uncoupling protein 2 determined by NMR molecular fragment replacement
PDB Compounds: (A:) Mitochondrial uncoupling protein 2

SCOPe Domain Sequences for d2lcka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lcka_ f.42.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mtvkflgagtaaciadlitfpldtakvrlqiqgesqglvrtaasaqyrgvlgtiltmvrt
egprslynglvaglqrqmsfasvriglydsvkqfytkgsehagigsrllagsttgalava
vaqptdvvkvrfqaqaragggrryqstveayktiareegirglwkgtspnvarnaivnca
elvtydlikdtllkanlmtddlpchftsafgagfcttviaspvdvvktrymnsalgqyhs
aghcaltmlrkegprafykgfmpsflrlgswnvvmfvtyeqlkralmaayqsreapf

SCOPe Domain Coordinates for d2lcka_:

Click to download the PDB-style file with coordinates for d2lcka_.
(The format of our PDB-style files is described here.)

Timeline for d2lcka_: