Lineage for d2lbha_ (2lbh A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383117Fold b.9: Neurophysin II [49605] (1 superfamily)
    sandwich; 8 strands in 2 sheets; meander
  4. 2383118Superfamily b.9.1: Neurophysin II [49606] (1 family) (S)
    duplication: composed of two structural repeats
    automatically mapped to Pfam PF00184
  5. 2383119Family b.9.1.1: Neurophysin II [49607] (1 protein)
  6. 2383120Protein Neurophysin II [49608] (1 species)
    can be classified as disulfide-rich
  7. 2383121Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries)
  8. 2383146Domain d2lbha_: 2lbh A: [242832]
    automated match to d1l5da_

Details for d2lbha_

PDB Entry: 2lbh (more details)

PDB Description: Solution Structure of the Dimeric Form of a Unliganded Bovine Neurophysin, Minimized Average Structure
PDB Compounds: (A:) neurophysin 1

SCOPe Domain Sequences for d2lbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lbha_ b.9.1.1 (A:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]}
avldldvrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
cgsggrcaaagiccspdgchedpacdpeaafs

SCOPe Domain Coordinates for d2lbha_:

Click to download the PDB-style file with coordinates for d2lbha_.
(The format of our PDB-style files is described here.)

Timeline for d2lbha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2lbhb_