SCOPe 2.05: Domain d2lbaa_: 2lba A:

Lineage for d2lbaa_ (2lba A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (16 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [255015] (2 PDB entries)

8. Domain d2lbaa_: 2lba A: [242830]
   automated match to d3em0b_
   complexed with cho

Details for d2lbaa_

PDB Entry: 2lba

PDB Description: Solution structure of chicken ileal BABP in complex with glycochenodeoxycholic acid

PDB Compounds: (A:) BABP protein

SCOPe Domain Sequences for d2lbaa_:

Sequence; same for both SEQRES and ATOM records:

>d2lbaa_ b.60.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
aftgkyefesdenyddfvkkiglpadkiemgrnckivtevvqngndftwtqhfpggrttt
nsftidkeadmetmggrkfkatvkmeggkivadfpnyhhtaeisggklveistssgvvyk
rtskkia

Timeline for d2lbaa_:

• d2lbaa_ first appeared in SCOPe 2.04
  
• d2lbaa_ is called d2lbaa1 in SCOPe 2.06
  
• d2lbaa_ appears in the current release, SCOPe 2.08, called d2lbaa1