Lineage for d3em0b_ (3em0 B:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily)
barrel, closed or opened; n=8, S=12; meanderSuperfamily b.60.1: Lipocalins [50814] (10 families) 
bind hydrophobic ligands in their interior
Family b.60.1.0: automated matches [191454] (1 protein)
not a true familyProtein automated matches [190698] (16 species)
not a true protein
Species Zebrafish (Danio rerio) [TaxId:7955] [188731] (3 PDB entries) 
Domain d3em0b_: 3em0 B: [175070]
automated match to d1o1ua_
complexed with chd
Details for d3em0b_
PDB Entry: 3em0 (more details), 2.2 Å
PDB Description: Crystal structure of Zebrafish Ileal Bile Acid-Bindin Protein complexed with cholic acid (crystal form B).
PDB Compounds: (B:) Ileal bile acid-binding proteinSCOPe Domain Sequences for d3em0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3em0b_ b.60.1.0 (B:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
safngkwetesqegyepfckligipddviakgrdfklvteivqngddftwtqyypnnhvv
tnkfivgkesdmetvggkkfkgivsmeggkltisfpkyqqtteisggklvetstasgaqg
tavlvrtskkvlvpr
SCOPe Domain Coordinates for d3em0b_:
Click to download the PDB-style file with coordinates for d3em0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3em0b_:
- d3em0b_ first appeared in SCOPe 2.01
- d3em0b_ appears in SCOPe 2.04
- d3em0b_ is called d3em0b1 in SCOPe 2.06
- d3em0b_ appears in the current release, SCOPe 2.08, called d3em0b1
View in 3D
