SCOPe 2.07: Domain d2l9ca1: 2l9c A:20-181

Lineage for d2l9ca1 (2l9c A:20-181)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188249] (10 PDB entries)

8. Domain d2l9ca1: 2l9c A:20-181 [242814]
   Other proteins in same PDB: d2l9ca2
   automated match to d1df3a_

Details for d2l9ca1

PDB Entry: 2l9c

PDB Description: Structural insights into the specificity of darcin, an atypical major urinary protein.

PDB Compounds: (A:) Darcin

SCOPe Domain Sequences for d2l9ca1:

Sequence; same for both SEQRES and ATOM records:

>d2l9ca1 b.60.1.1 (A:20-181) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eeassmernfnvekingewytimlatdkrekieehgsmrvfveyihvlenslalkfhiii
neecseiflvadktekageysvtydgsntftilktdydnyimihlinkkdgetfqlmely
grepdlssdikekfaqlseehgivreniidltnanrcleare

Timeline for d2l9ca1:

• d2l9ca1 first appeared in SCOPe 2.04, called d2l9ca_
  
• d2l9ca1 appears in SCOPe 2.06
  
• d2l9ca1 appears in the current release, SCOPe 2.08