Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
Protein automated matches [190971] (14 species) not a true protein |
Species Toxoplasma gondii [TaxId:5811] [255410] (1 PDB entry) |
Domain d2l72a_: 2l72 A: [242793] automated match to d2xf1a_ |
PDB Entry: 2l72 (more details)
SCOPe Domain Sequences for d2l72a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l72a_ d.109.1.0 (A:) automated matches {Toxoplasma gondii [TaxId: 5811]} masgmgvdencvarfnelkirktvkwivfkientkivvekdgkgnadefrgalpandcrf gvydcgnkiqfvlwcpdnapvkprmtyasskdallkkldgatavaleahemgdlapla
Timeline for d2l72a_: