Lineage for d2l72a_ (2l72 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969935Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2969936Protein automated matches [190971] (14 species)
    not a true protein
  7. 2970015Species Toxoplasma gondii [TaxId:5811] [255410] (1 PDB entry)
  8. 2970016Domain d2l72a_: 2l72 A: [242793]
    automated match to d2xf1a_

Details for d2l72a_

PDB Entry: 2l72 (more details)

PDB Description: Solution structure and dynamics of ADF from Toxoplasma gondii (TgADF)
PDB Compounds: (A:) Actin depolymerizing factor, putative

SCOPe Domain Sequences for d2l72a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l72a_ d.109.1.0 (A:) automated matches {Toxoplasma gondii [TaxId: 5811]}
masgmgvdencvarfnelkirktvkwivfkientkivvekdgkgnadefrgalpandcrf
gvydcgnkiqfvlwcpdnapvkprmtyasskdallkkldgatavaleahemgdlapla

SCOPe Domain Coordinates for d2l72a_:

Click to download the PDB-style file with coordinates for d2l72a_.
(The format of our PDB-style files is described here.)

Timeline for d2l72a_: