SCOPe 2.04: Domain d2l72a_: 2l72 A:

Lineage for d2l72a_ (2l72 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.0: automated matches [191561] (1 protein)
   not a true family

6. Protein automated matches [190971] (10 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:5811] [255410] (1 PDB entry)

8. Domain d2l72a_: 2l72 A: [242793]
   automated match to d2xf1a_

Details for d2l72a_

PDB Entry: 2l72

PDB Description: Solution structure and dynamics of ADF from Toxoplasma gondii (TgADF)

PDB Compounds: (A:) Actin depolymerizing factor, putative

SCOPe Domain Sequences for d2l72a_:

Sequence; same for both SEQRES and ATOM records:

>d2l72a_ d.109.1.0 (A:) automated matches {Toxoplasma gondii [TaxId: 5811]}
masgmgvdencvarfnelkirktvkwivfkientkivvekdgkgnadefrgalpandcrf
gvydcgnkiqfvlwcpdnapvkprmtyasskdallkkldgatavaleahemgdlapla

Timeline for d2l72a_:

• d2l72a_ is new in SCOPe 2.04-stable
  
• d2l72a_ appears in SCOPe 2.05
  
• d2l72a_ appears in the current release, SCOPe 2.08