SCOPe 2.07: Domain d1slla1: 1sll A:81-276

Lineage for d1slla1 (1sll A:81-276)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.9: Leech intramolecular trans-sialidase, N-terminal domain [49968] (1 protein)
   automatically mapped to Pfam PF02973
   automatically mapped to Pfam PF13385

6. Protein Leech intramolecular trans-sialidase, N-terminal domain [49969] (1 species)

7. Species North american leech (Macrobdella decora) [TaxId:6405] [49970] (5 PDB entries)

8. Domain d1slla1: 1sll A:81-276 [24277]
   Other proteins in same PDB: d1slla2

Details for d1slla1

PDB Entry: 1sll, 2 Å

PDB Description: sialidase l from leech macrobdella decora

PDB Compounds: (A:) sialidase l

SCOPe Domain Sequences for d1slla1:

Sequence; same for both SEQRES and ATOM records:

>d1slla1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]}
ipegilmeknnvdiaegqgysldqeagakyvkamtqgtiilsykstsengiqslfsvgns
tagnqdrhfhiyitnsggigielrntdgvfnytldrpasvralykgervfntvalkadaa
nkqcrlfangellatldkdafkfisditgvdnvtlggtkrqgkiaypfggtigdikvysn
alsdeeliqatgvtty

Timeline for d1slla1:

• d1slla1 first appeared (with stable ids) in SCOP 1.55, called d1sll_1
  
• d1slla1 appears in SCOPe 2.06
  
• d1slla1 appears in the current release, SCOPe 2.08