SCOPe 2.05: Domain d2l4ha_: 2l4h A:

Lineage for d2l4ha_ (2l4h A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186813] (23 PDB entries)

8. Domain d2l4ha_: 2l4h A: [242760]
   automated match to d1dgua_
   complexed with ca

Details for d2l4ha_

PDB Entry: 2l4h

PDB Description: The Solution Structure of Calcium Bound CIB1

PDB Compounds: (A:) Calcium and integrin-binding protein 1

SCOPe Domain Sequences for d2l4ha_:

Sequence; same for both SEQRES and ATOM records:

>d2l4ha_ a.39.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lskellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkan
pfkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnred
lsrlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassf
kivl

Timeline for d2l4ha_:

• d2l4ha_ first appeared in SCOPe 2.04
  
• d2l4ha_ appears in SCOPe 2.06
  
• d2l4ha_ appears in the current release, SCOPe 2.08