Lineage for d2l2ia1 (2l2i A:2-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803640Family b.55.1.9: TFIIH domain [110272] (3 proteins)
  6. 2803641Protein RNA polymerase II transcription factor B 73 kDa, TFB1 [141434] (2 species)
  7. 2803652Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [255399] (1 PDB entry)
  8. 2803653Domain d2l2ia1: 2l2i A:2-115 [242747]
    Other proteins in same PDB: d2l2ia2
    automated match to d1y5oa1

Details for d2l2ia1

PDB Entry: 2l2i (more details)

PDB Description: NMR Structure of the complex between the Tfb1 subunit of TFIIH and the activation domain of EKLF
PDB Compounds: (A:) RNA polymerase II transcription factor B subunit 1

SCOPe Domain Sequences for d2l2ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l2ia1 b.55.1.9 (A:2-115) RNA polymerase II transcription factor B 73 kDa, TFB1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
shsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmmlr
ligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

SCOPe Domain Coordinates for d2l2ia1:

Click to download the PDB-style file with coordinates for d2l2ia1.
(The format of our PDB-style files is described here.)

Timeline for d2l2ia1: