PDB entry 2l2i

View 2l2i on RCSB PDB site
Description: NMR Structure of the complex between the Tfb1 subunit of TFIIH and the activation domain of EKLF
Class: transcription
Keywords: Transcription Factor TFIIH, Erythroid Kruppel-Like Factor EKLF, Activator, Protein Structure, Mutation, Gene Expression Regulation, TRANSCRIPTION
Deposited on 2010-08-18, released 2011-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II transcription factor B subunit 1
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: D9740.3, TFB1, YDR311W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32776 (1-114)
      • expression tag (0)
    Domains in SCOPe 2.08: d2l2ia1, d2l2ia2
  • Chain 'B':
    Compound: Krueppel-like factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EKLF, KLF1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l2iA (A:)
pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

  • Chain 'B':
    No sequence available.