Lineage for d2l2ga1 (2l2g A:1524-1666)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074396Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 2074397Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 2074398Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. 2074456Protein automated matches [254500] (3 species)
    not a true protein
  7. 2074465Species Monodelphis domestica [TaxId:13616] [255397] (1 PDB entry)
  8. 2074466Domain d2l2ga1: 2l2g A:1524-1666 [242746]
    Other proteins in same PDB: d2l2ga2
    automated match to d1e6fb_

Details for d2l2ga1

PDB Entry: 2l2g (more details)

PDB Description: Solution structure of Opossum Domain 11
PDB Compounds: (A:) igf2r domain 11

SCOPe Domain Sequences for d2l2ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l2ga1 b.64.1.1 (A:1524-1666) automated matches {Monodelphis domestica [TaxId: 13616]}
mksniqdncqvtnpatghlfdlnslkndsgysvaysekgliyigicggtkncpsgvgvcf
gltkinagswnsqlmyvdqvlqlvyddgapcpsknalkyksvisfvcthdsgannkpvfv
sldkqtctlyfswhtplacekee

SCOPe Domain Coordinates for d2l2ga1:

Click to download the PDB-style file with coordinates for d2l2ga1.
(The format of our PDB-style files is described here.)

Timeline for d2l2ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2l2ga2