SCOPe 2.05: Domain d2l1da_: 2l1d A:

Lineage for d2l1da_ (2l1d A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [234629] (12 PDB entries)

8. Domain d2l1da_: 2l1d A: [242732]
   automated match to d1xyxa_

Details for d2l1da_

PDB Entry: 2l1d

PDB Description: Mouse prion protein (121-231) containing the substitution Y169G

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2l1da_:

Sequence; same for both SEQRES and ATOM records:

>d2l1da_ d.6.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsvvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqgsnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss

Timeline for d2l1da_:

• d2l1da_ first appeared in SCOPe 2.04
  
• d2l1da_ is called d2l1da1 in SCOPe 2.06
  
• d2l1da_ appears in the current release, SCOPe 2.08, called d2l1da1