![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
![]() | Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
![]() | Family d.6.1.1: Prion-like [54099] (3 proteins) |
![]() | Protein automated matches [191016] (9 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [234629] (15 PDB entries) |
![]() | Domain d2l1da1: 2l1d A:121-232 [242732] Other proteins in same PDB: d2l1da2 automated match to d1xyxa_ |
PDB Entry: 2l1d (more details)
SCOPe Domain Sequences for d2l1da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l1da1 d.6.1.1 (A:121-232) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqgsnqnnfvhdcv nitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss
Timeline for d2l1da1: