| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Interferon-alpha/beta receptor beta chain [89199] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89200] (4 PDB entries) |
| Domain d2kz1b2: 2kz1 B:110-206 [242708] Other proteins in same PDB: d2kz1a_ automated match to d2hyma2 |
PDB Entry: 2kz1 (more details)
SCOPe Domain Sequences for d2kz1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kz1b2 b.1.2.1 (B:110-206) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
pefeivgftnhinvmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyi
idklipntnycvsvylehsdeqaviksplkctllppg
Timeline for d2kz1b2: