SCOPe 2.08: Domain d1d0ha1: 1d0h A:875-1110

Lineage for d1d0ha1 (1d0h A:875-1110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
   automatically mapped to Pfam PF07953

6. Protein Tetanus neurotoxin [49957] (1 species)

7. Species Clostridium tetani [TaxId:1513] [49958] (10 PDB entries)

8. Domain d1d0ha1: 1d0h A:875-1110 [24265]
   Other proteins in same PDB: d1d0ha2
   complexed with a2g, so4

Details for d1d0ha1

PDB Entry: 1d0h, 2.1 Å

PDB Description: the hc fragment of tetanus toxin complexed with n-acetyl-galactosamine

PDB Compounds: (A:) protein (tetanus toxin hc)

SCOPe Domain Sequences for d1d0ha1:

Sequence; same for both SEQRES and ATOM records:

>d1d0ha1 b.29.1.6 (A:875-1110) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsyls

Timeline for d1d0ha1:

• d1d0ha1 first appeared (with stable ids) in SCOP 1.55
  
• d1d0ha1 appears in SCOPe 2.07