Lineage for d1d0ha1 (1d0h A:875-1110)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (2 proteins) Protein Tetanus neurotoxin [49957] (1 species) Species Clostridium tetani [49958] (6 PDB entries) 
Domain d1d0ha1: 1d0h A:875-1110 [24265]
Other proteins in same PDB: d1d0ha2
Details for d1d0ha1
PDB Entry: 1d0h (more details), 2.1 Å
PDB Description: the hc fragment of tetanus toxin complexed with n-acetyl-galactosamine
SCOP Domain Sequences for d1d0ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d0ha1 b.29.1.6 (A:875-1110) Tetanus neurotoxin {Clostridium tetani}
edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsyls
SCOP Domain Coordinates for d1d0ha1:
Click to download the PDB-style file with coordinates for d1d0ha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d0ha1:
- d1d0ha1 appears in SCOP 1.57
- d1d0ha1 appears in the current release, SCOPe 2.08
View in 3D
