Lineage for d2kqka_ (2kqk A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1686645Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 1686646Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 1686661Family d.224.1.2: NifU/IscU domain [102928] (5 proteins)
  6. 1686676Protein automated matches [254586] (3 species)
    not a true protein
  7. 1686681Species Escherichia coli [TaxId:562] [255370] (1 PDB entry)
  8. 1686682Domain d2kqka_: 2kqk A: [242615]
    automated match to d1r9pa_

Details for d2kqka_

PDB Entry: 2kqk (more details)

PDB Description: solution structure of apo-iscu(d39a)
PDB Compounds: (A:) NifU-like protein

SCOPe Domain Sequences for d2kqka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kqka_ d.224.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
maysekvidhyenprnvgsfdnndenvgsgmvgapacgavmklqikvndegiiedarfkt
ygcgsaiassslvtewvkgksldeaqaikntdiaeelelppvkihcsilaedaikaaiad
ykskreak

SCOPe Domain Coordinates for d2kqka_:

Click to download the PDB-style file with coordinates for d2kqka_.
(The format of our PDB-style files is described here.)

Timeline for d2kqka_: