SCOPe 2.04: Domain d2kp1a_: 2kp1 A:

Lineage for d2kp1a_ (2kp1 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.2: PDI-like [52849] (3 proteins)
   duplication: contains two tandem repeats of this fold

6. Protein automated matches [254585] (1 species)
   not a true protein

7. Species Fungus (Humicola insolens) [TaxId:34413] [255369] (1 PDB entry)

8. Domain d2kp1a_: 2kp1 A: [242606]
   automated match to d2djja1

Details for d2kp1a_

PDB Entry: 2kp1

PDB Description: solution structure of the a' domain of thermophilic fungal protein disulfide isomerase

PDB Compounds: (A:) Protein disulfide-isomerase

SCOPe Domain Sequences for d2kp1a_:

Sequence; same for both SEQRES and ATOM records:

>d2kp1a_ c.47.1.2 (A:) automated matches {Fungus (Humicola insolens) [TaxId: 34413]}
gplgsegpvtvvvaknyneivlddtkdvliefyapwcghckalapkyeelgalyaksefk
drvviakvdatandvpdeiqgfptiklypagakgqpvtysgsrtvedlikfiaengkyka
a

Timeline for d2kp1a_:

• d2kp1a_ is new in SCOPe 2.04-stable
  
• d2kp1a_ appears in SCOPe 2.05
  
• d2kp1a_ appears in the current release, SCOPe 2.08, called d2kp1a1