Lineage for d1gnhd_ (1gnh D:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 164914Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 164915Protein C-reactive protein (CRP) [49954] (1 species)
  7. 164916Species Human (Homo sapiens) [TaxId:9606] [49955] (3 PDB entries)
  8. 164935Domain d1gnhd_: 1gnh D: [24255]

Details for d1gnhd_

PDB Entry: 1gnh (more details), 3 Å

PDB Description: human c-reactive protein

SCOP Domain Sequences for d1gnhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnhd_ b.29.1.5 (D:) C-reactive protein (CRP) {Human (Homo sapiens)}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

SCOP Domain Coordinates for d1gnhd_:

Click to download the PDB-style file with coordinates for d1gnhd_.
(The format of our PDB-style files is described here.)

Timeline for d1gnhd_: