SCOPe 2.07: Domain d2kkqa1: 2kkq A:11-116

Lineage for d2kkqa1 (2kkq A:11-116)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2kkqa1: 2kkq A:11-116 [242545]
   Other proteins in same PDB: d2kkqa2
   automated match to d1g1ca_

Details for d2kkqa1

PDB Entry: 2kkq

PDB Description: solution nmr structure of the ig-like c2-type 2 domain of human myotilin. northeast structural genomics target hr3158.

PDB Compounds: (A:) Myotilin

SCOPe Domain Sequences for d2kkqa1:

Sequence; same for both SEQRES and ATOM records:

>d2kkqa1 b.1.1.0 (A:11-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehkrapmfiykpqskkvlegdsvklecqisaipppklfwkrnnemvqfntdrislyqdnt
grvtllikdvnkkdagwytvsavneagvttcntrldvtarpnqtlp

Timeline for d2kkqa1:

• d2kkqa1 first appeared in SCOPe 2.04, called d2kkqa_
  
• d2kkqa1 appears in SCOPe 2.06
  
• d2kkqa1 appears in the current release, SCOPe 2.08