Class g: Small proteins [56992] (100 folds) |
Fold g.53: TAZ domain [57932] (1 superfamily) all-alpha fold; Zn-binding sites are in the loops connecting helices |
Superfamily g.53.1: TAZ domain [57933] (1 family) automatically mapped to Pfam PF02135 |
Family g.53.1.1: TAZ domain [57934] (2 proteins) |
Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [75696] (3 PDB entries) |
Domain d2kjea_: 2kje A: [242539] automated match to d1f81a_ protein/DNA complex; complexed with zn |
PDB Entry: 2kje (more details)
SCOPe Domain Sequences for d2kjea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kjea_ g.53.1.1 (A:) CREB-binding transcriptional adaptor protein CBP (p300) {Human (Homo sapiens) [TaxId: 9606]} spqesrrlsiqrciqslvhacqcrnancslpscqkmkrvvqhtkgckrktnggcpvckql ialccyhakhcqenkcpvpfclnikhklrqqq
Timeline for d2kjea_: