Lineage for d2kjea_ (2kje A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038292Fold g.53: TAZ domain [57932] (1 superfamily)
    all-alpha fold; Zn-binding sites are in the loops connecting helices
  4. 3038293Superfamily g.53.1: TAZ domain [57933] (1 family) (S)
    automatically mapped to Pfam PF02135
  5. 3038294Family g.53.1.1: TAZ domain [57934] (2 proteins)
  6. 3038295Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species)
  7. 3038296Species Human (Homo sapiens) [TaxId:9606] [75696] (3 PDB entries)
  8. 3038297Domain d2kjea_: 2kje A: [242539]
    automated match to d1f81a_
    protein/DNA complex; complexed with zn

Details for d2kjea_

PDB Entry: 2kje (more details)

PDB Description: nmr structure of cbp taz2 and adenoviral e1a complex
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d2kjea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kjea_ g.53.1.1 (A:) CREB-binding transcriptional adaptor protein CBP (p300) {Human (Homo sapiens) [TaxId: 9606]}
spqesrrlsiqrciqslvhacqcrnancslpscqkmkrvvqhtkgckrktnggcpvckql
ialccyhakhcqenkcpvpfclnikhklrqqq

SCOPe Domain Coordinates for d2kjea_:

Click to download the PDB-style file with coordinates for d2kjea_.
(The format of our PDB-style files is described here.)

Timeline for d2kjea_: