Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) |
Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) |
Protein automated matches [190485] (10 species) not a true protein |
Species Mexican scorpion (Centruroides noxius) [TaxId:6878] [255351] (1 PDB entry) |
Domain d2kjaa_: 2kja A: [242534] automated match to d1jzaa_ |
PDB Entry: 2kja (more details)
SCOPe Domain Sequences for d2kjaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kjaa_ g.3.7.1 (A:) automated matches {Mexican scorpion (Centruroides noxius) [TaxId: 6878]} kegylvnkstgckygclllgknegcdkeckaknqggsygycyafgcwceglpestptypl pnkscs
Timeline for d2kjaa_: