Lineage for d2kjaa_ (2kja A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635215Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 2635304Protein automated matches [190485] (10 species)
    not a true protein
  7. 2635332Species Mexican scorpion (Centruroides noxius) [TaxId:6878] [255351] (1 PDB entry)
  8. 2635333Domain d2kjaa_: 2kja A: [242534]
    automated match to d1jzaa_

Details for d2kjaa_

PDB Entry: 2kja (more details)

PDB Description: chemical shift assignments, constraints, and coordinates for cn5 scorpion toxin
PDB Compounds: (A:) Beta-toxin Cn5

SCOPe Domain Sequences for d2kjaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kjaa_ g.3.7.1 (A:) automated matches {Mexican scorpion (Centruroides noxius) [TaxId: 6878]}
kegylvnkstgckygclllgknegcdkeckaknqggsygycyafgcwceglpestptypl
pnkscs

SCOPe Domain Coordinates for d2kjaa_:

Click to download the PDB-style file with coordinates for d2kjaa_.
(The format of our PDB-style files is described here.)

Timeline for d2kjaa_: