Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (29 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:28450] [255338] (1 PDB entry) |
Domain d2ke0a1: 2ke0 A:5-117 [242475] Other proteins in same PDB: d2ke0a2 automated match to d2y78a_ |
PDB Entry: 2ke0 (more details)
SCOPe Domain Sequences for d2ke0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ke0a1 d.26.1.0 (A:5-117) automated matches {Burkholderia pseudomallei [TaxId: 28450]} mtvvttesglkyedltegsgaearagqtvsvhytgwltdgqkfdsskdrndpfafvlggg mvikgwdegvqgmkvggvrrltippqlgygargaggvippnatlvfevelldv
Timeline for d2ke0a1: