Lineage for d2ke0a1 (2ke0 A:5-117)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941690Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2941691Protein automated matches [191162] (29 species)
    not a true protein
  7. 2941703Species Burkholderia pseudomallei [TaxId:28450] [255338] (1 PDB entry)
  8. 2941704Domain d2ke0a1: 2ke0 A:5-117 [242475]
    Other proteins in same PDB: d2ke0a2
    automated match to d2y78a_

Details for d2ke0a1

PDB Entry: 2ke0 (more details)

PDB Description: Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d2ke0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ke0a1 d.26.1.0 (A:5-117) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mtvvttesglkyedltegsgaearagqtvsvhytgwltdgqkfdsskdrndpfafvlggg
mvikgwdegvqgmkvggvrrltippqlgygargaggvippnatlvfevelldv

SCOPe Domain Coordinates for d2ke0a1:

Click to download the PDB-style file with coordinates for d2ke0a1.
(The format of our PDB-style files is described here.)

Timeline for d2ke0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ke0a2