Lineage for d1lgne_ (1lgn E:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 944683Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 944751Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 944752Species Human (Homo sapiens) [TaxId:9606] [49953] (9 PDB entries)
  8. 944807Domain d1lgne_: 1lgn E: [24246]
    complexed with ca, da

Details for d1lgne_

PDB Entry: 1lgn (more details), 2.8 Å

PDB Description: decameric damp complex of human serum amyloid p component
PDB Compounds: (E:) serum amyloid p component

SCOPe Domain Sequences for d1lgne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lgne_ b.29.1.5 (E:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOPe Domain Coordinates for d1lgne_:

Click to download the PDB-style file with coordinates for d1lgne_.
(The format of our PDB-style files is described here.)

Timeline for d1lgne_: