Lineage for d2kbxa_ (2kbx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006665Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 3006666Protein automated matches [191267] (8 species)
    not a true protein
  7. 3006685Species Human (Homo sapiens) [TaxId:9606] [189837] (21 PDB entries)
  8. 3006730Domain d2kbxa_: 2kbx A: [242459]
    automated match to d4hi8a_
    complexed with zn

Details for d2kbxa_

PDB Entry: 2kbx (more details)

PDB Description: solution structure of ilk-pinch complex
PDB Compounds: (A:) Integrin-linked protein kinase

SCOPe Domain Sequences for d2kbxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kbxa_ d.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mddiftqcregnavavrlwldntendlnqgddhgfsplhwacregrsavvemlimrgari
nvmnrgddtplhlaashghrdivqkllqykadinavnehgnvplhyacfwgqdqvaedlv
angalvsicnkygempvdkakaplrellreraekmgqnlnripykdtfwkg

SCOPe Domain Coordinates for d2kbxa_:

Click to download the PDB-style file with coordinates for d2kbxa_.
(The format of our PDB-style files is described here.)

Timeline for d2kbxa_: