![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) ![]() |
![]() | Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins) automatically mapped to Pfam PF00708 |
![]() | Protein automated matches [191024] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188822] (6 PDB entries) |
![]() | Domain d2k7ja1: 2k7j A:2-99 [242399] Other proteins in same PDB: d2k7ja2 automated match to d2acya_ |
PDB Entry: 2k7j (more details)
SCOPe Domain Sequences for d2k7ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k7ja1 d.58.10.1 (A:2-99) automated matches {Human (Homo sapiens) [TaxId: 9606]} aegntlisvdyeifgkvqgvffrkhtqaegkklglvgwvqntdrgtvqgklqgpiskvre mqkwletrgspeshidkanfknekvilkldysdfqivk
Timeline for d2k7ja1: